News > ParisTech Business Angels & Startups

Pour en savoir plus sur le groupe, authentifiez vous.

 
11
Déc
'19

Lettre d'information Externe - Décembre 2019 N°111

 voir l'en-tête complet fermer l'en-tête

Return-Path: <srs0=fr8h=2a=business-angels.info=secretariat@netanswer.fr>
Received: from mwinf5c20 (mwinf5c20 [10.223.111.70]) by mwinb1604 with LMTPA; Tue, 10 Dec 2019 19:56:09 +0100
X-Sieve: CMU Sieve 2.3
Received: from namail2.netanswer.fr ([91.109.120.29]) by mwinf5c20 with ME id cJw92100i0e926K01Jw9Zy; Tue, 10 Dec 2019 19:56:09 +0100
X-bcc: paristech-forum@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (17)(0011)gggruggvucftvghtrhhoucdtuddrgedufedrudelfedgudduhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghi lhhouhhtmecugedttdenucdnofetkffnkffpifculddujedmnecujfgurhepvffufffhrhfkofggtgfgsegrkeerphehtdejnecuhfhrohhmpefrlhgrthgvfhhorhhmvg cuueetugfigfcuoehsvggtrhgvthgrrhhirghtsegsuhhsihhnvghsshdqrghnghgvlhhsrdhinhhfoheqnecuffhomhgrihhnpegsuhhsihhnvghsshdqrghnghgvlhhs rdhinhhfohenucfkphepledurddutdelrdduvddtrddvledpheegrdefiedrudeljedrgeenucfrrghrrghmpehhvghlohepnhgrmhgrihhlvddrnhgvthgrnhhsfigvrh drfhhrpdhinhgvthepledurddutdelrdduvddtrddvledpmhgrihhlfhhrohhmpehsrhhstdepfhhrkehhpedvrgepsghushhinhgvshhsqdgrnhhgvghlshdrihhnfhho pehsvggtrhgvthgrrhhirghtsehnvghtrghnshifvghrrdhfrhdprhgtphhtthhopehprghrihhsthgvtghhqdhfohhruhhmsehorhgrnhhgvgdrfhhrnecuvehluhhsth gvrhfuihiivgephe
X-me-spamlevel: not-spam
X-ME-Helo: namail2.netanswer.fr
X-ME-IP: 91.109.120.29
X-ME-Entity: ofr
Received: from namx0.netanswer.fr (mx0.netanswer.fr [192.168.201.10]) by namail2.netanswer.fr (Postfix) with ESMTP id 5A6DF4B2099; Tue, 10 Dec 2019 19:56:09 +0100 (CET)
Authentication-Results: namail2.netanswer.fr; dkim=pass reason="1024-bit key; insecure key" header.d=business-angels.info header.i=@business-angels.info header.b=VoyezmiT; dkim-adsp=pass; dkim-atps=neutral
Received: from localhost (inamx1.netanswer.fr [192.168.201.11]) by namx0.netanswer.fr (Postfix) with ESMTP id 4F3B21216D7; Tue, 10 Dec 2019 19:56:09 +0100 (CET)
X-Virus-Scanned: Debian amavisd-new at namx1.netanswer.fr
Received: from namx0.netanswer.fr ([192.168.201.10]) by localhost (namx1.netanswer.fr [192.168.201.11]) (amavisd-new, port 10024) with LMTP id bAuaHbnTK279; Tue, 10 Dec 2019 19:56:06 +0100 (CET)
Received: from hr-ch94-1.reseller.mis.ovh.net (ip4.ip-54-36-197.eu [54.36.197.4]) (using TLSv1.2 with cipher ADH-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mx0.netanswer.fr (Postfix) with ESMTPS id 6DAF31216DA for <contact@paristech-alumni.org>; Tue, 10 Dec 2019 19:56:04 +0100 (CET)
Received: by hr-ch94-1.reseller.mis.ovh.net (Postfix, from userid 10010) id BDCF862256; Tue, 10 Dec 2019 18:59:23 +0000 (UTC)
To: Contact <contact@paristech-alumni.org>
Subject: =?utf-8?Q?Lettre_d'information_Externe_-_D=C3=A9cembre_2019_N=C2=B0111?=
DKIM-Signature: v=1; a=rsa-sha1; q=dns/txt; l=211377; s=acy; t=1576004363; c=relaxed/simple; h=from:to:subject; d=business-angels.info; bh=QHjs/AMBnjt2jfcRzYISYEru3fE=; b=VoyezmiTeuwtwnxlDyljkKdEyoiryFy+ut53IJgkSSGr76DpFBg6OV67fyAE IC4mdJqbJN22DpZPP4Xl41WnhFDbmUzhBZaLElHZ0EK6R3aPeJ3okrBhtg3Y iHTqhBO1lHyfhCSCJ7XXy5+zGhpPM8jw8/IcF21LhgHZe1qj4KU=
Date: Tue, 10 Dec 2019 18:59:13 +0000
From: Plateforme BAdGE <secretariat@business-angels.info>
Reply-To: Plateforme BAdGE <secretariat@business-angels.info>
Message-ID: <NTY4NDEzMgAC5758Y328BAMTU3NjAwNDM2MzI0OTA3@business-angels.info>
X-Mailer: PHPMailer 5.2.19 (https://github.com/PHPMailer/PHPMailer)
MIME-Version: 1.0
Content-Type: multipart/alternative; boundary="b1_808c84275a4e3617a83b1f4dedb97d46"
Content-Transfer-Encoding: 8bit

#message .ReadMsgBody { width: 100%; background-color: #ebebeb;} #message .ExternalClass {width: 100%; background-color: #ebebeb;} #message .ExternalClass,#message .ExternalClass p,#message .ExternalClass span,#message .ExternalClass font,#message .ExternalClass td,#message .ExternalClass div {line-height:100%;} #message a[x-apple-data-detectors]{ color:inherit !important; text-decoration:none !important; font-size:inherit !important; font-family:inherit !important; font-weight:inherit !important; line-height:inherit !important;} #message body {-webkit-text-size-adjust:none; -ms-text-size-adjust:none;} #message body {margin:0; padding:0;} #message .yshortcuts a {border-bottom: none !important;} #message .rnb-del-min-width{ min-width: 0 !important;} #message .templateContainer{ max-width:590px !important; width:auto !important;} #message img[class="rnb-col-3-img"] { max-width:170px;} #message img[class="rnb-col-2-img"] { max-width:264px;} #message img[class="rnb-col-2-img-side-xs"] { max-width:180px;} #message img[class="rnb-col-2-img-side-xl"] { max-width:350px;} #message img[class="rnb-col-1-img"] { max-width:550px;} #message img[class="rnb-header-img"] { max-width:590px;} #message .rnb-force-col p,#message ul,#message ol{margin:0px!important;} #message .rnb-del-min-width p,#message ul,#message ol{margin:0px!important;} #message .rnb-tmpl-width{ width:100%!important;} #message .rnb-social-width{padding-right:15px!important;} #message .rnb-social-align{float:right!important;} #message li{mso-margin-top-alt: 0; mso-margin-bottom-alt: 0;} #message table {mso-table-lspace:0pt; mso-table-rspace:0pt;} #message table,#message tr,#message td {border-collapse: collapse;} #message p,#message a,#message li,#message blockquote {mso-line-height-rule:exactly;} #message .msib-right-img { mso-padding-alt: 0 !important;} #message .content-spacing div {display: list-item; list-style-type: none;} @media only screen and (min-width:590px){ .templateContainer{width:590px !important;} } @media screen and (max-width: 360px){ .rnb-yahoo-width{ width:360px !important;} } @media screen and (max-width: 380px){ .element-img-text{ font-size:24px !important;} #message .element-img-text2{ width:230px !important;} #message .content-img-text-tmpl-6{ font-size:24px !important;} #message .content-img-text2-tmpl-6{ width:220px !important;} } @media screen and (max-width: 480px) { td[class="rnb-container-padding"] { padding-left: 10px !important; padding-right: 10px !important;} #message td.rnb-force-nav { display: inherit;} #message .rnb-social-text-left { width: 100%; text-align: center; margin-bottom: 15px;} #message .rnb-social-text-right { width: 100%; text-align: center;} } @media only screen and (max-width: 600px) { .rnb-text-center {text-align:center !important;} #message td.rnb-force-col { display: block; padding-right: 0 !important; padding-left: 0 !important; width:100%;} #message table.rnb-container { width: 100% !important;} #message table.rnb-btn-col-content { width: 100% !important;} #message table.rnb-col-3 { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px; } #message table.rnb-last-col-3 { float: none !important; width: 100% !important;} #message table.rnb-col-2 { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px; } #message table.rnb-col-2-noborder-onright { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px;} #message table.rnb-col-2-noborder-onleft { float: none !important; width: 100% !important; margin-top: 10px; padding-top: 10px;} #message table.rnb-last-col-2 { float: none !important; width: 100% !important;} #message table.rnb-col-1 { float: none !important; width: 100% !important;} #message img.rnb-col-3-img { width:100% !important;} #message img.rnb-col-2-img { width:100% !important;} #message img.rnb-col-2-img-side-xs { width:100% !important;} #message img.rnb-col-2-img-side-xl { width:100% !important;} #message img.rnb-col-1-img { width:100% !important;} #message img.rnb-header-img { width:100% !important; margin:0 auto;} #message img.rnb-logo-img { width:100% !important;} #message td.rnb-mbl-float-none { float:inherit !important;} #message .img-block-center{text-align:center !important;} #message .logo-img-center { float:inherit !important;} #message .rnb-social-align{margin:0 auto !important; float:inherit !important;} #message .rnb-social-center{display:inline-block;} #message .social-text-spacing{margin-bottom:0px !important; padding-bottom:0px !important;} #message .social-text-spacing2{padding-top:15px !important;} } } #message table{border-spacing: 0;} #message table td {border-collapse: collapse;} }

   
 
 

Lettre d'information Externe Décembre 2019 - N°111

 
 
ÉDITO
 

Notre association créée en novembre 2004 a tout juste 15 ans. A cette occasion, je souhaite rendre hommage à son initiateur et premier Président, François Cherruau. Très impliqué dans l’Entreprenariat et la Création d’Entreprises, Président d’X Création et d’X Entrepreneurs, dans un premier temps il a regroupé moins d’une dizaine de membres, puis 40 jusqu’à la promulgation de la Loi TEPA qui a rapidement fait passer le nombre d’adhérents à plus de 200 membres.

 

La progression de l’association fut rapide avec 5 investissements en 2005 pour un montant de 144 k€. Puis 22 investissements pour plus de 2M€ trois ans plus tard. Clairement, le partage de risque avec l’Etat grâce à la défiscalisation a été très efficace.

15 ans après, notre bilan est respectable : plus de 170 sociétés financées, 145 tours ultérieurs de financement apportés pour leur développement. Des milliers d’heures de travail de nos bénévoles ont rendu cela possible.

Notre action a été reconnue lors de deux belles réunions qui se sont tenues en novembre dernier :

  • Lors de la Plénière Inter-réseaux des Business Angels d’Ile de France au cours de laquelle Paul-François Fournier, Directeur Exécutif de Bpifrance en charge de l’Innovation et Alexandra Dublanche, Présidente de la commission du Développement économique, de l’Emploi et de l’Innovation d’Ile de France ont souligné l’importance des Réseaux de BA pour la création d’Entreprise. Rappelons à ce titre que pour l’octroi de son financement French Tech Seed, Bpifrance souhaite l’entrée au capital « d’Investisseurs Avisés » et compte beaucoup sur notre financement.
  • A l’occasion d’une réunion à l’Ecole Nationale Supérieure de Chimie de Rennes, Franck Zal, Fondateur et Président d’HEMARINA, start-up très prometteuse dans le domaine de la santé a expliqué que rien n’aurait été possible sans le soutien des Business Angels : Finistère Angels et BADGE.

Je vous souhaite bonne lecture de cette lettre avec une très intéressante interview de Philippe Louvel de notre membre associé Plasseraud IP, spécialiste de Propriété Industrielle. Ainsi que de passer de très belles fêtes de Noël et de fin d’année.

Amicalement, Jacques Tamisier Président des Business Angels des Grandes Écoles

 
 
 
 
 
 
 
PROPRIÉTÉ INTELLECTUELLE ET START-UPS
 
 
Philippe Louvel, Associé Plasseraud IP Conseil en Propriété Industrielle / Mandataire Européen
 

Un titre de propriété intellectuelle ("PI"), qu’est-ce que c’est et à quoi ça sert ?

Un titre de propriété intellectuelle peut revêtir plusieurs formes, en fonction du type d’objet que l’on souhaite protéger: un brevet protégera des innovations à caractère technique, alors qu’une marque aura vocation à protéger un signe distinctif, et un dessin et modèle protégera une création esthétique, autrement dit le design du produit.

 

Dans le cas de start-ups, notamment celles à contenu technique/technologique, c’est souvent le brevet qui est l’actif clé.

Ces droits et titres de propriété confèrent à leur propriétaire un droit d’interdire aux autres d’exploiter l’invention, d’utiliser la marque ou de reproduire la création objet de la protection. Ce sont donc des armes qui permettent d’attaquer en justice les copieurs et de faire stopper la contrefaçon par un tribunal. Elles offrent donc un véritable avantage concurrentiel et produisent un effet très dissuasif pour les concurrents qui envisageraient de venir sur votre terrain.

Ces droits constituent par ailleurs un fort outil de négociation et, surtout, rassurent les investisseurs. Un droit de PI c’est en effet un actif de la société qui la valorise (un brevet peut valoir plusieurs millions d’euros), permettent de lever des fonds et de générer des revenus (par exemple grâce à l’octroi de licences).

Enfin, posséder des droits de PI, c’est bénéficier d’un avantage marketing qui crédibilise votre technologie : une technologie protégée par brevet sera perçue comme plus solide qu’une innovation technique qui ne l’est pas.

Q : Pourquoi la protection de sa propriété intellectuelle est-elle particulièrement importante pour une start-up ?

La PI est importante pour toutes les entreprises, mais ça l’est d’autant plus pour les start-ups. Au-delà du potentiel humain des porteurs du projet, ce qui fait la valeur d’une start-up, c’est sa propriété intellectuelle. Au printemps 2017, Mines ParisTech avait conduit une étude pour France Brevets auprès d'un échantillon de 800 start-ups qui a révélé que les start-ups qui protègent leur PI ont trois fois plus de chances de réussir.

C’est un levier que pourraient davantage utiliser les start-ups françaises pour surpasser leurs voisins européens. Par exemple, 23 % des jeunes entreprises en Allemagne détiennent au moins un brevet en phase d'amorçage, contre 15 % en France.
Q : Pouvez-vous nous donner quelques exemples de success stories ?

Voici trois exemples dont le premier, OncoDiag, a été financé par BADGE

 
 
 

Q : Un autre exemple ?

Oui le cas HEMARINA, une autre réussite soutenue par BADGE.

 
 

Spin-off du CNRS et de Sorbonne Université (Paris VI), HEMARINA voit le jour en 2007, en Bretagne. La technologie HEMARINA, unique et brevetée (13 familles de brevets), repose sur la seule hémoglobine naturellement extracellulaire de haut poids moléculaire, fonctionnant sur une large plage de température (de 4°C à 37°C) et ne nécessitant aucun cofacteur pour libérer l'oxygène.

 

Q : Et les marques ?

Il s’agit aussi d’un atout critique, qui, lorsqu’il est bien positionné, accompagne positivement le succès d’une solution technique. On peut déposer non seulement le nom de l’entreprise comme OncoDiag®, mais aussi les produits qu’elle commercialise comme URODIAG® COLODIAG®.

Un autre exemple : Hemarina® a créé une déclinaison de marques pour ses produits dérivés : Hemo2life®, HEMHealing®, HEMOXYCarrier®, HEMOXCell®.

A condition de la renouveler et de l’utiliser, une marque n’a pas de limite de durée, alors qu’un brevet une fois expiré au bout de 20 ans, tombe dans le domaine public.

 

♣ ♣ ♣

 
 
 
 
PROCHAINS RENDEZ-VOUS >>> PRÉSENTATIONS DE PROJETS
 

Réunions mensuelles avec présentation de projets innovants en recherche de fonds

animées par Michel Huet, Secrétaire Général, chargé de l'Instruction.  Adhérents inscrivez-vous. Non-adhérents, demandez votre invitation. 

 
 
Mardi 17 Décembre 2019 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
Mardi 21 Janvier 2020 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris  

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 

Retrouvez nos prochaines dates de réunion en 2020 :

https://business-angels.info/actualites

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
NOS ACTUALITÉS
 
 
 
 
Retour sur la Plénière inter-réseaux du Jeudi 28 novembre 2019
 

Jeudi 28 novembre 2019 à 18h, six réseaux de BA d’Île-de-France se réunissaient à l’Espace Carpeaux de Courbevoie pour la seconde édition de cette Plénière inter-réseaux.

Au préalable, chaque réseau (Angels Santé, Arts et Métiers Business Angels, les Business Angels des Grandes Ecoles, Femmes Business Angels, Paris Business Angels et Val’Angels) avait présenté une start-up susceptible de pitcher en Plénière Deux projets particulièrement porteurs, en recherche de financement, avaient été retenus par les organisateurs et se sont présentés à la centaine de Business Angels réunis ce jour là.

Paul-François Fournier, Directeur Exécutif de Bpifrance en charge de l’Innovation et Alexandra Dublanche, Présidente de la commission du Développement économique, de l’Emploi et de l’Innovation d’Ile de France ont souligné l’importance des Réseaux de Business Angels pour la création d’Entreprise. Charazed Djebbari, Adjointe au Maire, Emploi et développement économique présentait les actions de Courbevoie en matière d’accompagnement des start-up avec le Catalyseur de l’Innovation et de l’entrepreneuriat Paris Ouest La Défense (POLD).

A l’issue des pitchs des sociétés Inex et Pledg, l’organisation inter-réseaux recueillait 380 k€ d’intentions d’investissement parmi les 80 personnes ayant participé au sondage en ligne, dont 250 k€ pour Inex et 130 k€ pour Pledg.

 
 

iNex-Circular, société de services pour l’environnement. Faire des déchets des uns (des industries), la matière première de l’autre (les ressources de leurs voisins).

 

Pledg, nouvelle solution de paiement pour booster les achats en ligne.

 

Ces deux finalistes étaient précédés par l'elevator pitch de Nocode-Solutions start-up hébergée par le Catalyseur de l’Innovation et de l’entrepreneuriat Paris Ouest La Défense (POLD).

 
 
Voir la vidéo de l'événement
 
 
 
 
 
 
 
RÉSEAU & PARTENAIRES
 
 
1ères Rencontres « Les ressources financières au service du développement des territoires »
 

Bpifrance (Paris), 16 décembre 2019

 
Programme & Inscriptions
 
Université d’automne France Angels
 

Strasbourg, 13 et 14 novembre 2019

Quand les réseaux de Business Angels, leurs membres, les membres associés, les acteurs de l’écosystème et les partenaires se rencontrent pour échanger les bonnes pratiques, développer les liens entre les réseaux et les autres acteurs du financement de proximité.

 
En savoir +
 
 
 
 
 
 
NOS DERNIERS CLOSINGS
 
 

BADGE et ses adhérents ont contribué à la plus forte levée (165000€) réalisée auprès de quatre autres réseaux de BA afin de développer OAKBOT, la première machine de fraisage à commande numérique portative au monde pour les charpentiers.

 
Lire le communiqué
 

Belle mobilisation des investisseurs de BADGE pour la 2e levée de fonds Telegrafik ; 13 membres et la SIBA BADGE 2019 investissent 130 k€ pour financer le développement de cette start-up toulousaine, acteur du Smart Care (Silver Economy).

 

Neta, société de Nouvelle Aquitaine qui conçoit, produit et commercialise des solutions d’imagerie innovantes, vient de boucler sa levée auprès de trois réseaux de Business Angels. Les adhérents de BADGE ont contribué à hauteur de 108 k€, le fonds régional NACO abondant les participations des BAs individuels.

 

BADGE accompagne Agripolis Organics depuis sa première augmentation de capital en 2017 et vient de participer à une nouvelle opération. 16 investisseurs individuels de BADGE et la SIBA 2019 ont contribué à hauteur de 123 k€ en actions et 20 k€ en obligations.

 

Agripolis, société innovante est un fournisseur de fermes urbaines produisant des fruits et des légumes locaux et sains, qui organisent la résilience environnementale et économique des villes et proposent des services qui redonnent du sens à l’alimentation. Cette levée de fonds, d’un montant total de 600 k€ comportait deux volets ; une augmentation de capital et l’émission d’obligations convertibles. Elle est destinée à assurer le développement de l’entreprise et notamment le démarrage de ce qui sera la plus grande ferme urbaine en terrasse du monde à la Porte de Versailles à Paris.

 
 
En savoir +
 
 
 
 
 
 
 
NOUVELLES DE NOS START-UP
 
 
 
 

Algentech vient de boucler son investissement en actions convertibles. Un brevet US accordé après une longue procédure permettra de booster son développement.

 
 
 
 

Carole Danancher, fondatrice de Kannelle la start-up soutenue par BADGE, spécialisée dans la création de vidéos d’entreprise à partir d’un smartphone, le powerpoint de demain, assurait cette prestation pour les organisateurs de la Plénière inter-réseaux du 28 novembre 2019.

 
Voir la vidéo
 
 
 

Les Business Angels des Grandes Écoles Siège : 12 rue de Poitiers - 75007 Paris Bureaux : 15 rue du Colonel Driant - 75001 Paris Tel : 01 42 22 67 35 secretariat@business-angels.info

www.business-angels.info

 
 
 
 

>>> COMITÉ DE RÉDACTION Jacques Tamisier, Président Paul Leondaridis, Délégué Général Véronique Dupont [ Adressez votre sujet à la rédaction ]

 
 

Se désabonner" style="">>>> Pour mettre à jour vos informations ou vous désabonner de notre newsletter  <<<

 

Vous devez être logué pour laisser des commentaires.



Recherche



Evènements

04 Avril 2020

Île-de-France: Cimetière du Père Lachaise - Samedi 04/04/2020 à 9h15 :
visite...

Lire la suite

07 Avril 2020

Période de crise : gérer ses émotions, prévenir le stress :
Quels comportements positifs adopter en période de crise ? COMPRENDRE SES BESOINS ...

Lire la suite

07 Avril 2020

---Reporté--- Afterwork Ponts Alumni à Rennes :
           Afterwork reporté à...

Lire la suite

11 Avril 2020

REPORTE - Fanfare (gratuit) : Kiosque du Jardin Villemin (Paris Xe) :
 ...

Lire la suite

14 Avril 2020

Marchés, Bourse ... Comment prendre les bonnes décisions dans la crise actuelle du coronavirus ? :
Compte tenu d'un grand nombre de demandes, une seconde conférence en ligne est o...

Lire la suite

14 Avril 2020

Rhône-Alpes : Coach ta carrière : ATELIER RESEAUX : partie 1 :
Emploi...

Lire la suite

16 Avril 2020

Apér'Agro à Tours - Rdz-vs mensuel :
Soirée conviviale et réseautage...

Lire la suite

20 Avril 2020

Webinar : Facilitate efficient remote meetings in new techs era ! NEW - COMPLET :
Organize and structure efficient online meetings. Explore common communication protocols f...

Lire la suite

20 Avril 2020

Connaissance de soi, profiler? Atelier animé par Xavier Clerfeuille :
Atelier sous une autre forme adaptée à la visioconférence : 45 m...

Lire la suite

21 Avril 2020

Séminaire - Identifier et se réapproprier ses solidités les 21 et 28 avril 2020 (pour la deuxième séance) :
Piloter son parcours professionnel, se repositionner...

Lire la suite

21 Avril 2020

Carrières * Identifier et se réapproprier ses solidités les 21 et 28 avril 2020 (pour la deuxième séance) :
Piloter son parcours professionnel, se repositionner...

Lire la suite

22 Avril 2020

Carrières * Webinar : Sharpen your pitch ! :
Build and practice on a multipurpose pitch, to improve your comfort zone in any given situ...

Lire la suite

22 Avril 2020

Carrières * L'expatriation : un expert à l'international vous répond :
Un projet performant à l’international, c’est la recherche simultan&eac...

Lire la suite

24 Avril 2020

Week-end en Bourgogne :
Visite thématique...

Lire la suite

25 Avril 2020

Fanfare (gratuit) : Brocante Toutocoto (St Cloud, 92) :
 ...

Lire la suite

27 Avril 2020

Carrières * Analysez votre profil LinkedIn et boostez votre recherche d’emploi grâce à LinkedIn :
Faites auditer votre profil LinkedIn par un expert des réseaux sociaux   ...

Lire la suite

28 Avril 2020

Séminaire - Identifier et se réapproprier ses solidités les 21 et 28 avril 2020 (pour la deuxième séance) :
Piloter son parcours professionnel, se repositionner...

Lire la suite

28 Avril 2020

Business Angels des Grandes Ecoles : Présentation de projets d'entrepreneurs :
PONTS Business Angels vous convie à la réunion mensuelle de présent...

Lire la suite

28 Avril 2020

Agro Dirigeants - Atelier mobilité et réseau :
Networking - Echanges sur les projets de mobilité professionnelle ...

Lire la suite

29 Avril 2020

Carrières * Webinar : Trucs astucieux pour organiser votre recherche d'emploi :
Structurer efficacement votre recherche d’emploi et organiser vos actions Arbitre...

Lire la suite

05 Mai 2020

Rhône-Alpes : Coach ta carrière : ATELIER RESEAUX : partie 2 :
Emploi...

Lire la suite

07 Mai 2020

Carrières * Webinar : Optimiser son profil LinkedIn ! :
LinkedIn est le réseau social professionnel incontournable !Créer votre prof...

Lire la suite

12 Mai 2020

Carrières * Webinar : Réussir ma carrière grâce au Personal Branding :
vous démarquer, montrer votre valeur ajoutée face à des recruteurs,...

Lire la suite

12 Mai 2020

Rhône-Alpes : Coach ta carrière : OUTILS DU RESEAU : partie 1 :
Emploi...

Lire la suite

12 Mai 2020

Atelier | Après 50 ans, travailler autrement :
Préparer sa retraite...

Lire la suite

14 Mai 2020

Webinar - PERSONAL (RE)BRANDING :
UniAgro, en partenariat avec Intermines et l'Emlyon, vous proposent de participer à...

Lire la suite

14 Mai 2020

Apér'Agro à Tours - Rdz-vs mensuel :
Soirée conviviale et réseautage...

Lire la suite

15 Mai 2020

Déj'Agro mensuel à Orléans :
Déjeuner convivial et réseautage...

Lire la suite

16 Mai 2020

Cycle de formation professionnelle : "Réussissez vos collectifs. Renforcez vos Soft Skills " les samedis 16, 30 mai et 13 juin :
A l’ère du numérique, les soft skills sont notre richesse diffé...

Lire la suite

16 Mai 2020

Île-de-France: Assemblée Générale - 16/05/2020 :
Les bénévoles de votre Groupement Régional Île-de-France ont le...

Lire la suite

16 Mai 2020

Réunion de promo Samedi 16 et dimanche 17 mai à Chinon :
Visite, sport et degustation... avec Jean Pouzet...

Lire la suite

17 Mai 2020

Concert Mozart/Schubert à la salle Wagram :
Concert classique...

Lire la suite

19 Mai 2020

Business Angels des Grandes Ecoles : Présentation de projets d'entrepreneurs :
PONTS Business Angels vous convie à la réunion mensuelle de présent...

Lire la suite

23 Mai 2020

Fanfare (gratuit) : Kiosque de la place de la Nation (Paris XIIe) :
 ...

Lire la suite

26 Mai 2020

Cycle de formation professionnelle : Développement durable, Climat, Énergie et autres Les 26, 27 et 28 mai :
Formation assurée par Arclès (Conseil et Direction)...

Lire la suite

26 Mai 2020

Rhône-Alpes : Coach ta carrière : OUTILS DU RESEAU : partie 2 :
Emploi...

Lire la suite

28 Mai 2020

Gestion des conflits et médiation :
Précisions à venir...

Lire la suite

29 Mai 2020

Cycle de formation professionnelle : "Réussissez vos collectifs. Renforcez vos Soft Skills " les vendredis 29 mai, 12 et 19 juin :
A l’ère du numérique, les soft skills sont notre richesse diffé...

Lire la suite

30 Mai 2020

Randonnée dans les Vosges - [Scherwiller] :
Intermines Alsace, l'ARISAL (IESF Alsace) et le VDI Schwarzwald t'invitent à une ...

Lire la suite

02 Juin 2020

ROMEO ET JULIETTE à la Seine Musicale :
Ballet...

Lire la suite

07 Juin 2020

Visite de la ferme du Chant des cailles :
Agriculture urbaine, participative et écologique...

Lire la suite

09 Juin 2020

Atelier - Réussir sa stratégie de recherche d emploi :
Réseauter et conduire sa recherche d'emploi...

Lire la suite

10 Juin 2020

Votre repositionnement professionnel MODE D'EMPLOI par François Baleynaud :
OBJECTIFS DE LA SESSION Vous réfléchissez à un poste qui fasse plus ...

Lire la suite

11 Juin 2020

Agro Dirigeants - Atelier mobilité et réseau :
Networking - Echanges sur les projets de mobilité professionnelle ...

Lire la suite

12 Juin 2020

Déj'Agro mensuel à Orléans :
Déjeuner convivial et réseautage...

Lire la suite

13 Juin 2020

Rhône-Alpes : Atelier "Réveille ton étoile" :
Atelier...

Lire la suite

16 Juin 2020

Business Angels des Grandes Ecoles : Présentation de projets d'entrepreneurs :
PONTS Business Angels vous convie à la réunion mensuelle de présent...

Lire la suite

18 Juin 2020

Carrières * Allo CV "Spécial Docteurs" :
Votre CV est-il adapté à votre objectif professionnel ? Echangez au t&eacut...

Lire la suite

18 Juin 2020

Apér'Agro à Tours - Rdz-vs mensuel :
Soirée conviviale et réseautage...

Lire la suite

19 Juin 2020

Visite de la centrale nucléaire de Fessenheim - [Fessenheim] :
***Evénement COMPLET - Inscriptions avant le 27 avril*** (une liste d'attente est...

Lire la suite

Ajoutez un message personnel