News > ParisTech Business Angels & Startups

Pour en savoir plus sur le groupe, authentifiez vous.

 
11
Déc
'19

Lettre d'information Externe - Décembre 2019 N°111

 voir l'en-tête complet fermer l'en-tête

Return-Path: <srs0=fr8h=2a=business-angels.info=secretariat@netanswer.fr>
Received: from mwinf5c20 (mwinf5c20 [10.223.111.70]) by mwinb1604 with LMTPA; Tue, 10 Dec 2019 19:56:09 +0100
X-Sieve: CMU Sieve 2.3
Received: from namail2.netanswer.fr ([91.109.120.29]) by mwinf5c20 with ME id cJw92100i0e926K01Jw9Zy; Tue, 10 Dec 2019 19:56:09 +0100
X-bcc: paristech-forum@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (17)(0011)gggruggvucftvghtrhhoucdtuddrgedufedrudelfedgudduhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghi lhhouhhtmecugedttdenucdnofetkffnkffpifculddujedmnecujfgurhepvffufffhrhfkofggtgfgsegrkeerphehtdejnecuhfhrohhmpefrlhgrthgvfhhorhhmvg cuueetugfigfcuoehsvggtrhgvthgrrhhirghtsegsuhhsihhnvghsshdqrghnghgvlhhsrdhinhhfoheqnecuffhomhgrihhnpegsuhhsihhnvghsshdqrghnghgvlhhs rdhinhhfohenucfkphepledurddutdelrdduvddtrddvledpheegrdefiedrudeljedrgeenucfrrghrrghmpehhvghlohepnhgrmhgrihhlvddrnhgvthgrnhhsfigvrh drfhhrpdhinhgvthepledurddutdelrdduvddtrddvledpmhgrihhlfhhrohhmpehsrhhstdepfhhrkehhpedvrgepsghushhinhgvshhsqdgrnhhgvghlshdrihhnfhho pehsvggtrhgvthgrrhhirghtsehnvghtrghnshifvghrrdhfrhdprhgtphhtthhopehprghrihhsthgvtghhqdhfohhruhhmsehorhgrnhhgvgdrfhhrnecuvehluhhsth gvrhfuihiivgephe
X-me-spamlevel: not-spam
X-ME-Helo: namail2.netanswer.fr
X-ME-IP: 91.109.120.29
X-ME-Entity: ofr
Received: from namx0.netanswer.fr (mx0.netanswer.fr [192.168.201.10]) by namail2.netanswer.fr (Postfix) with ESMTP id 5A6DF4B2099; Tue, 10 Dec 2019 19:56:09 +0100 (CET)
Authentication-Results: namail2.netanswer.fr; dkim=pass reason="1024-bit key; insecure key" header.d=business-angels.info header.i=@business-angels.info header.b=VoyezmiT; dkim-adsp=pass; dkim-atps=neutral
Received: from localhost (inamx1.netanswer.fr [192.168.201.11]) by namx0.netanswer.fr (Postfix) with ESMTP id 4F3B21216D7; Tue, 10 Dec 2019 19:56:09 +0100 (CET)
X-Virus-Scanned: Debian amavisd-new at namx1.netanswer.fr
Received: from namx0.netanswer.fr ([192.168.201.10]) by localhost (namx1.netanswer.fr [192.168.201.11]) (amavisd-new, port 10024) with LMTP id bAuaHbnTK279; Tue, 10 Dec 2019 19:56:06 +0100 (CET)
Received: from hr-ch94-1.reseller.mis.ovh.net (ip4.ip-54-36-197.eu [54.36.197.4]) (using TLSv1.2 with cipher ADH-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mx0.netanswer.fr (Postfix) with ESMTPS id 6DAF31216DA for <contact@paristech-alumni.org>; Tue, 10 Dec 2019 19:56:04 +0100 (CET)
Received: by hr-ch94-1.reseller.mis.ovh.net (Postfix, from userid 10010) id BDCF862256; Tue, 10 Dec 2019 18:59:23 +0000 (UTC)
To: Contact <contact@paristech-alumni.org>
Subject: =?utf-8?Q?Lettre_d'information_Externe_-_D=C3=A9cembre_2019_N=C2=B0111?=
DKIM-Signature: v=1; a=rsa-sha1; q=dns/txt; l=211377; s=acy; t=1576004363; c=relaxed/simple; h=from:to:subject; d=business-angels.info; bh=QHjs/AMBnjt2jfcRzYISYEru3fE=; b=VoyezmiTeuwtwnxlDyljkKdEyoiryFy+ut53IJgkSSGr76DpFBg6OV67fyAE IC4mdJqbJN22DpZPP4Xl41WnhFDbmUzhBZaLElHZ0EK6R3aPeJ3okrBhtg3Y iHTqhBO1lHyfhCSCJ7XXy5+zGhpPM8jw8/IcF21LhgHZe1qj4KU=
Date: Tue, 10 Dec 2019 18:59:13 +0000
From: Plateforme BAdGE <secretariat@business-angels.info>
Reply-To: Plateforme BAdGE <secretariat@business-angels.info>
Message-ID: <NTY4NDEzMgAC5758Y328BAMTU3NjAwNDM2MzI0OTA3@business-angels.info>
X-Mailer: PHPMailer 5.2.19 (https://github.com/PHPMailer/PHPMailer)
MIME-Version: 1.0
Content-Type: multipart/alternative; boundary="b1_808c84275a4e3617a83b1f4dedb97d46"
Content-Transfer-Encoding: 8bit

#message .ReadMsgBody { width: 100%; background-color: #ebebeb;} #message .ExternalClass {width: 100%; background-color: #ebebeb;} #message .ExternalClass,#message .ExternalClass p,#message .ExternalClass span,#message .ExternalClass font,#message .ExternalClass td,#message .ExternalClass div {line-height:100%;} #message a[x-apple-data-detectors]{ color:inherit !important; text-decoration:none !important; font-size:inherit !important; font-family:inherit !important; font-weight:inherit !important; line-height:inherit !important;} #message body {-webkit-text-size-adjust:none; -ms-text-size-adjust:none;} #message body {margin:0; padding:0;} #message .yshortcuts a {border-bottom: none !important;} #message .rnb-del-min-width{ min-width: 0 !important;} #message .templateContainer{ max-width:590px !important; width:auto !important;} #message img[class="rnb-col-3-img"] { max-width:170px;} #message img[class="rnb-col-2-img"] { max-width:264px;} #message img[class="rnb-col-2-img-side-xs"] { max-width:180px;} #message img[class="rnb-col-2-img-side-xl"] { max-width:350px;} #message img[class="rnb-col-1-img"] { max-width:550px;} #message img[class="rnb-header-img"] { max-width:590px;} #message .rnb-force-col p,#message ul,#message ol{margin:0px!important;} #message .rnb-del-min-width p,#message ul,#message ol{margin:0px!important;} #message .rnb-tmpl-width{ width:100%!important;} #message .rnb-social-width{padding-right:15px!important;} #message .rnb-social-align{float:right!important;} #message li{mso-margin-top-alt: 0; mso-margin-bottom-alt: 0;} #message table {mso-table-lspace:0pt; mso-table-rspace:0pt;} #message table,#message tr,#message td {border-collapse: collapse;} #message p,#message a,#message li,#message blockquote {mso-line-height-rule:exactly;} #message .msib-right-img { mso-padding-alt: 0 !important;} #message .content-spacing div {display: list-item; list-style-type: none;} @media only screen and (min-width:590px){ .templateContainer{width:590px !important;} } @media screen and (max-width: 360px){ .rnb-yahoo-width{ width:360px !important;} } @media screen and (max-width: 380px){ .element-img-text{ font-size:24px !important;} #message .element-img-text2{ width:230px !important;} #message .content-img-text-tmpl-6{ font-size:24px !important;} #message .content-img-text2-tmpl-6{ width:220px !important;} } @media screen and (max-width: 480px) { td[class="rnb-container-padding"] { padding-left: 10px !important; padding-right: 10px !important;} #message td.rnb-force-nav { display: inherit;} #message .rnb-social-text-left { width: 100%; text-align: center; margin-bottom: 15px;} #message .rnb-social-text-right { width: 100%; text-align: center;} } @media only screen and (max-width: 600px) { .rnb-text-center {text-align:center !important;} #message td.rnb-force-col { display: block; padding-right: 0 !important; padding-left: 0 !important; width:100%;} #message table.rnb-container { width: 100% !important;} #message table.rnb-btn-col-content { width: 100% !important;} #message table.rnb-col-3 { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px; } #message table.rnb-last-col-3 { float: none !important; width: 100% !important;} #message table.rnb-col-2 { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px; } #message table.rnb-col-2-noborder-onright { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px;} #message table.rnb-col-2-noborder-onleft { float: none !important; width: 100% !important; margin-top: 10px; padding-top: 10px;} #message table.rnb-last-col-2 { float: none !important; width: 100% !important;} #message table.rnb-col-1 { float: none !important; width: 100% !important;} #message img.rnb-col-3-img { width:100% !important;} #message img.rnb-col-2-img { width:100% !important;} #message img.rnb-col-2-img-side-xs { width:100% !important;} #message img.rnb-col-2-img-side-xl { width:100% !important;} #message img.rnb-col-1-img { width:100% !important;} #message img.rnb-header-img { width:100% !important; margin:0 auto;} #message img.rnb-logo-img { width:100% !important;} #message td.rnb-mbl-float-none { float:inherit !important;} #message .img-block-center{text-align:center !important;} #message .logo-img-center { float:inherit !important;} #message .rnb-social-align{margin:0 auto !important; float:inherit !important;} #message .rnb-social-center{display:inline-block;} #message .social-text-spacing{margin-bottom:0px !important; padding-bottom:0px !important;} #message .social-text-spacing2{padding-top:15px !important;} } } #message table{border-spacing: 0;} #message table td {border-collapse: collapse;} }

   
 
 

Lettre d'information Externe Décembre 2019 - N°111

 
 
ÉDITO
 

Notre association créée en novembre 2004 a tout juste 15 ans. A cette occasion, je souhaite rendre hommage à son initiateur et premier Président, François Cherruau. Très impliqué dans l’Entreprenariat et la Création d’Entreprises, Président d’X Création et d’X Entrepreneurs, dans un premier temps il a regroupé moins d’une dizaine de membres, puis 40 jusqu’à la promulgation de la Loi TEPA qui a rapidement fait passer le nombre d’adhérents à plus de 200 membres.

 

La progression de l’association fut rapide avec 5 investissements en 2005 pour un montant de 144 k€. Puis 22 investissements pour plus de 2M€ trois ans plus tard. Clairement, le partage de risque avec l’Etat grâce à la défiscalisation a été très efficace.

15 ans après, notre bilan est respectable : plus de 170 sociétés financées, 145 tours ultérieurs de financement apportés pour leur développement. Des milliers d’heures de travail de nos bénévoles ont rendu cela possible.

Notre action a été reconnue lors de deux belles réunions qui se sont tenues en novembre dernier :

  • Lors de la Plénière Inter-réseaux des Business Angels d’Ile de France au cours de laquelle Paul-François Fournier, Directeur Exécutif de Bpifrance en charge de l’Innovation et Alexandra Dublanche, Présidente de la commission du Développement économique, de l’Emploi et de l’Innovation d’Ile de France ont souligné l’importance des Réseaux de BA pour la création d’Entreprise. Rappelons à ce titre que pour l’octroi de son financement French Tech Seed, Bpifrance souhaite l’entrée au capital « d’Investisseurs Avisés » et compte beaucoup sur notre financement.
  • A l’occasion d’une réunion à l’Ecole Nationale Supérieure de Chimie de Rennes, Franck Zal, Fondateur et Président d’HEMARINA, start-up très prometteuse dans le domaine de la santé a expliqué que rien n’aurait été possible sans le soutien des Business Angels : Finistère Angels et BADGE.

Je vous souhaite bonne lecture de cette lettre avec une très intéressante interview de Philippe Louvel de notre membre associé Plasseraud IP, spécialiste de Propriété Industrielle. Ainsi que de passer de très belles fêtes de Noël et de fin d’année.

Amicalement, Jacques Tamisier Président des Business Angels des Grandes Écoles

 
 
 
 
 
 
 
PROPRIÉTÉ INTELLECTUELLE ET START-UPS
 
 
Philippe Louvel, Associé Plasseraud IP Conseil en Propriété Industrielle / Mandataire Européen
 

Un titre de propriété intellectuelle ("PI"), qu’est-ce que c’est et à quoi ça sert ?

Un titre de propriété intellectuelle peut revêtir plusieurs formes, en fonction du type d’objet que l’on souhaite protéger: un brevet protégera des innovations à caractère technique, alors qu’une marque aura vocation à protéger un signe distinctif, et un dessin et modèle protégera une création esthétique, autrement dit le design du produit.

 

Dans le cas de start-ups, notamment celles à contenu technique/technologique, c’est souvent le brevet qui est l’actif clé.

Ces droits et titres de propriété confèrent à leur propriétaire un droit d’interdire aux autres d’exploiter l’invention, d’utiliser la marque ou de reproduire la création objet de la protection. Ce sont donc des armes qui permettent d’attaquer en justice les copieurs et de faire stopper la contrefaçon par un tribunal. Elles offrent donc un véritable avantage concurrentiel et produisent un effet très dissuasif pour les concurrents qui envisageraient de venir sur votre terrain.

Ces droits constituent par ailleurs un fort outil de négociation et, surtout, rassurent les investisseurs. Un droit de PI c’est en effet un actif de la société qui la valorise (un brevet peut valoir plusieurs millions d’euros), permettent de lever des fonds et de générer des revenus (par exemple grâce à l’octroi de licences).

Enfin, posséder des droits de PI, c’est bénéficier d’un avantage marketing qui crédibilise votre technologie : une technologie protégée par brevet sera perçue comme plus solide qu’une innovation technique qui ne l’est pas.

Q : Pourquoi la protection de sa propriété intellectuelle est-elle particulièrement importante pour une start-up ?

La PI est importante pour toutes les entreprises, mais ça l’est d’autant plus pour les start-ups. Au-delà du potentiel humain des porteurs du projet, ce qui fait la valeur d’une start-up, c’est sa propriété intellectuelle. Au printemps 2017, Mines ParisTech avait conduit une étude pour France Brevets auprès d'un échantillon de 800 start-ups qui a révélé que les start-ups qui protègent leur PI ont trois fois plus de chances de réussir.

C’est un levier que pourraient davantage utiliser les start-ups françaises pour surpasser leurs voisins européens. Par exemple, 23 % des jeunes entreprises en Allemagne détiennent au moins un brevet en phase d'amorçage, contre 15 % en France.
Q : Pouvez-vous nous donner quelques exemples de success stories ?

Voici trois exemples dont le premier, OncoDiag, a été financé par BADGE

 
 
 

Q : Un autre exemple ?

Oui le cas HEMARINA, une autre réussite soutenue par BADGE.

 
 

Spin-off du CNRS et de Sorbonne Université (Paris VI), HEMARINA voit le jour en 2007, en Bretagne. La technologie HEMARINA, unique et brevetée (13 familles de brevets), repose sur la seule hémoglobine naturellement extracellulaire de haut poids moléculaire, fonctionnant sur une large plage de température (de 4°C à 37°C) et ne nécessitant aucun cofacteur pour libérer l'oxygène.

 

Q : Et les marques ?

Il s’agit aussi d’un atout critique, qui, lorsqu’il est bien positionné, accompagne positivement le succès d’une solution technique. On peut déposer non seulement le nom de l’entreprise comme OncoDiag®, mais aussi les produits qu’elle commercialise comme URODIAG® COLODIAG®.

Un autre exemple : Hemarina® a créé une déclinaison de marques pour ses produits dérivés : Hemo2life®, HEMHealing®, HEMOXYCarrier®, HEMOXCell®.

A condition de la renouveler et de l’utiliser, une marque n’a pas de limite de durée, alors qu’un brevet une fois expiré au bout de 20 ans, tombe dans le domaine public.

 

♣ ♣ ♣

 
 
 
 
PROCHAINS RENDEZ-VOUS >>> PRÉSENTATIONS DE PROJETS
 

Réunions mensuelles avec présentation de projets innovants en recherche de fonds

animées par Michel Huet, Secrétaire Général, chargé de l'Instruction.  Adhérents inscrivez-vous. Non-adhérents, demandez votre invitation. 

 
 
Mardi 17 Décembre 2019 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
Mardi 21 Janvier 2020 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris  

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 

Retrouvez nos prochaines dates de réunion en 2020 :

https://business-angels.info/actualites

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
NOS ACTUALITÉS
 
 
 
 
Retour sur la Plénière inter-réseaux du Jeudi 28 novembre 2019
 

Jeudi 28 novembre 2019 à 18h, six réseaux de BA d’Île-de-France se réunissaient à l’Espace Carpeaux de Courbevoie pour la seconde édition de cette Plénière inter-réseaux.

Au préalable, chaque réseau (Angels Santé, Arts et Métiers Business Angels, les Business Angels des Grandes Ecoles, Femmes Business Angels, Paris Business Angels et Val’Angels) avait présenté une start-up susceptible de pitcher en Plénière Deux projets particulièrement porteurs, en recherche de financement, avaient été retenus par les organisateurs et se sont présentés à la centaine de Business Angels réunis ce jour là.

Paul-François Fournier, Directeur Exécutif de Bpifrance en charge de l’Innovation et Alexandra Dublanche, Présidente de la commission du Développement économique, de l’Emploi et de l’Innovation d’Ile de France ont souligné l’importance des Réseaux de Business Angels pour la création d’Entreprise. Charazed Djebbari, Adjointe au Maire, Emploi et développement économique présentait les actions de Courbevoie en matière d’accompagnement des start-up avec le Catalyseur de l’Innovation et de l’entrepreneuriat Paris Ouest La Défense (POLD).

A l’issue des pitchs des sociétés Inex et Pledg, l’organisation inter-réseaux recueillait 380 k€ d’intentions d’investissement parmi les 80 personnes ayant participé au sondage en ligne, dont 250 k€ pour Inex et 130 k€ pour Pledg.

 
 

iNex-Circular, société de services pour l’environnement. Faire des déchets des uns (des industries), la matière première de l’autre (les ressources de leurs voisins).

 

Pledg, nouvelle solution de paiement pour booster les achats en ligne.

 

Ces deux finalistes étaient précédés par l'elevator pitch de Nocode-Solutions start-up hébergée par le Catalyseur de l’Innovation et de l’entrepreneuriat Paris Ouest La Défense (POLD).

 
 
Voir la vidéo de l'événement
 
 
 
 
 
 
 
RÉSEAU & PARTENAIRES
 
 
1ères Rencontres « Les ressources financières au service du développement des territoires »
 

Bpifrance (Paris), 16 décembre 2019

 
Programme & Inscriptions
 
Université d’automne France Angels
 

Strasbourg, 13 et 14 novembre 2019

Quand les réseaux de Business Angels, leurs membres, les membres associés, les acteurs de l’écosystème et les partenaires se rencontrent pour échanger les bonnes pratiques, développer les liens entre les réseaux et les autres acteurs du financement de proximité.

 
En savoir +
 
 
 
 
 
 
NOS DERNIERS CLOSINGS
 
 

BADGE et ses adhérents ont contribué à la plus forte levée (165000€) réalisée auprès de quatre autres réseaux de BA afin de développer OAKBOT, la première machine de fraisage à commande numérique portative au monde pour les charpentiers.

 
Lire le communiqué
 

Belle mobilisation des investisseurs de BADGE pour la 2e levée de fonds Telegrafik ; 13 membres et la SIBA BADGE 2019 investissent 130 k€ pour financer le développement de cette start-up toulousaine, acteur du Smart Care (Silver Economy).

 

Neta, société de Nouvelle Aquitaine qui conçoit, produit et commercialise des solutions d’imagerie innovantes, vient de boucler sa levée auprès de trois réseaux de Business Angels. Les adhérents de BADGE ont contribué à hauteur de 108 k€, le fonds régional NACO abondant les participations des BAs individuels.

 

BADGE accompagne Agripolis Organics depuis sa première augmentation de capital en 2017 et vient de participer à une nouvelle opération. 16 investisseurs individuels de BADGE et la SIBA 2019 ont contribué à hauteur de 123 k€ en actions et 20 k€ en obligations.

 

Agripolis, société innovante est un fournisseur de fermes urbaines produisant des fruits et des légumes locaux et sains, qui organisent la résilience environnementale et économique des villes et proposent des services qui redonnent du sens à l’alimentation. Cette levée de fonds, d’un montant total de 600 k€ comportait deux volets ; une augmentation de capital et l’émission d’obligations convertibles. Elle est destinée à assurer le développement de l’entreprise et notamment le démarrage de ce qui sera la plus grande ferme urbaine en terrasse du monde à la Porte de Versailles à Paris.

 
 
En savoir +
 
 
 
 
 
 
 
NOUVELLES DE NOS START-UP
 
 
 
 

Algentech vient de boucler son investissement en actions convertibles. Un brevet US accordé après une longue procédure permettra de booster son développement.

 
 
 
 

Carole Danancher, fondatrice de Kannelle la start-up soutenue par BADGE, spécialisée dans la création de vidéos d’entreprise à partir d’un smartphone, le powerpoint de demain, assurait cette prestation pour les organisateurs de la Plénière inter-réseaux du 28 novembre 2019.

 
Voir la vidéo
 
 
 

Les Business Angels des Grandes Écoles Siège : 12 rue de Poitiers - 75007 Paris Bureaux : 15 rue du Colonel Driant - 75001 Paris Tel : 01 42 22 67 35 secretariat@business-angels.info

www.business-angels.info

 
 
 
 

>>> COMITÉ DE RÉDACTION Jacques Tamisier, Président Paul Leondaridis, Délégué Général Véronique Dupont [ Adressez votre sujet à la rédaction ]

 
 

Se désabonner" style="">>>> Pour mettre à jour vos informations ou vous désabonner de notre newsletter  <<<

 

Vous devez être logué pour laisser des commentaires.



Recherche



Evènements

18 Février 2020

Carrières * Webinar " Se faire recruter... dans la haute fonction publique territoriale " :
La présentation abordera les points suivants : Les débouchés ...

Lire la suite

20 Février 2020

Réunion mensuelle de février 2020 :
Jeudi 20 février, réunion mensuelle au cours de laquelle M. Denis Bauchard, ...

Lire la suite

20 Février 2020

Cycle de formation : devenir un communicant agile avec la "process com" :
Mieux se connaitre et développer sa communication...

Lire la suite

20 Février 2020

Cycle de Formation professionnelle : Devenir un communicant agile avec la "process com" :
Mieux se connaitre et développer sa communication...

Lire la suite

20 Février 2020

Visite guidée de l'Hôtel Dieu le jeudi 20 février :
Visite guidée de l'Hôtel Dieu le jeudi 20 févriersuivie d'un dî...

Lire la suite

20 Février 2020

Apér'Agro à Tours - Rdz-vs mensuel :
Soirée conviviale et réseautage...

Lire la suite

25 Février 2020

Rencontre Groupe territorial Occitanie le 25 février 2020 :
Cyril Portalez, Président du Groupe territorial Occitanie vous convie à...

Lire la suite

25 Février 2020

Business Angels des Grandes Ecoles : Présentation de projets d'entrepreneurs :
PONTS Business Angels vous convie à la réunion mensuelle de présent...

Lire la suite

25 Février 2020

Techniques et Pratiques de la Recherche d’Emploi par Pierre-Henri Multon :
Les ateliers « Techniques et Pratiques de la Recherche d’Emploi&n...

Lire la suite

26 Février 2020

"Les entreprises libérées, futur des organisations ou impasse ?" :
Organisé par l'ACADI...

Lire la suite

27 Février 2020

La valorisation des actifs immatériels au service de la performance de l’entreprise :
Business Mentoring et Management des Organisations...

Lire la suite

27 Février 2020

Carrières * Allo CV "Spécial Docteurs" :
Votre CV est-il adapté à votre objectif professionnel ? Echangez au t&eacut...

Lire la suite

27 Février 2020

Carrières * Webinar : Dépasser ses freins pour passer à l'action :
Prendre conscience de vos propres freins au passage à l’action - Le...

Lire la suite

28 Février 2020

Cycle logement X-Ponts Pierre - Visite des Bains-Douches : logements en structure bois :
Le groupe X-Ponts Pierre a le plaisir de vous convier, dans le cadre de son cycle 201...

Lire la suite

29 Février 2020

Carrières * Mettre en valeur ses compétences professionnelles pour activer sa recherche :
Les Alumni en poste n'ont que peu de temps à consacrer à leur recherche d'...

Lire la suite

29 Février 2020

Atelier - Faire le point sur ses compétences professionnelles et Activer sa recherche :
UniAgro, en partenariat avec Intermines, Edhec Alumni et ESCP Europe Alumni,vous proposent...

Lire la suite

29 Février 2020

Île-de-France:Visite du Lycée Hoche : ancien Couvent de la Reine à Versailles, sa chapelle et son musée. - 29/02/2020 à 15h00 :
Les bénévoles du GRIF vous convient à une nouvelle activité &...

Lire la suite

02 Mars 2020

Conférence et pitch :
Préparation des rencontres ASAGE carrières 2020 - atelier 4...

Lire la suite

03 Mars 2020

Carrières * Cycle de formation professionnelle "Expérimenter l’intelligence collective avec le co-développement" :
OBJECTIFS VISÉS Prendre du recul pour mieux se connaitre comme manager et am&eac...

Lire la suite

04 Mars 2020

Atelier Carrières : Comment rater ta recherche d'emploi ? Les 15 erreurs à éviter par Isabelle Ruffin-Sathicq :
Pas facile de mener une recherche d'emploi. De gros enjeux : d'amour propre, financiers,...

Lire la suite

04 Mars 2020

Carrières * Pitcher avec charisme :
Comme le pitch d'un film ou d'un livre, votre pitch professionnel doit pouvoir accrocher...

Lire la suite

04 Mars 2020

Comment rater sa recherche d'emploi ? Les 15 erreurs à éviter :
Pas facile de mener une recherche d'emploi. De gros enjeux : d'amour propre, financiers,...

Lire la suite

05 Mars 2020

Agro Dirigeants - Atelier mobilité et réseau :
Networking - Echanges sur les projets de mobilité professionnelle ...

Lire la suite

05 Mars 2020

Soirée métiers du 5 mars :
Transport, Logistique, Energie, Eau, Santé, Technologie de l'information et de la communi...

Lire la suite

05 Mars 2020

Switch collective : * Outplacement en ligne ( le soir ou le midi) :
Une aventure collective de 8 semaines pour aider à passer de la réflexion &a...

Lire la suite

06 Mars 2020

Visite du Swiss Plasma Center à Lausanne :
Possible d'amener vos enfants à partir de 9 ans https://www.epfl.ch/research/doma...

Lire la suite

09 Mars 2020

Conférence d'Henri Jannet : « Créateurs d'entreprises et Business Angels : quelles relations ? » :
Dans le développement d’une start-up arrive souvent le moment où la je...

Lire la suite

09 Mars 2020

Atelier - Donnez une vraie et bonne image de vous ! :
Uniagro, en partenariat avec Intermines, vous propose de participer à cet atelier, ...

Lire la suite

09 Mars 2020

Donnez une vraie et bonne image de vous :
- Prendre conscience de l’image que vous véhiculez et de son impact sur les a...

Lire la suite

09 Mars 2020

Pénurie de compétences : la reconversion va-t-elle sauver le numérique ? :
Un événement de l'Institut G9+...

Lire la suite

09 Mars 2020

Conseil Administration UniAgro :
  A l'attention des membres du Conseil d'Administration d'Uniagro Bonjour &agrav...

Lire la suite

10 Mars 2020

Carrières * Webinar : Le management de transition : une opportunité pour managers et dirigeants expérimentés :
- Le marché - Les missions - Les profils - Le modus operandi Ce webinar est pou...

Lire la suite

10 Mars 2020

Conférence - Dîner sur la Section de Recherche de la Gendarmerie des Transports Aériens :
Criminalité organisée, accidentologie et délinquance aéronautique, renseignements, coopéra...

Lire la suite

10 Mars 2020

Les Mardis du Quai Voltaire - Au feu ! Que devons-nous faire pour nos forêts ? :
Soirée-débat en partenariat avec AgroParitech ALUMNI Mardi 10 mars 202...

Lire la suite

11 Mars 2020

Conférence : Du garage à l'usine (du futur) : une nouvelle dimension dans l'accélération des startups hardware :
Conférencier : Bertrand Marquet - Co-Fondateur et Président de « ...

Lire la suite

12 Mars 2020

Carrières * Webinar : Work on your professional project :
  Objectives : Build and customize your professional proje...

Lire la suite

13 Mars 2020

Rhône-Alpes : Atelier "Réveille ton étoile" :
Atelier...

Lire la suite

13 Mars 2020

Déj'Agro mensuel à Orléans :
Déjeuner convivial et réseautage...

Lire la suite

14 Mars 2020

Île-de-France: Objectif MARS - 14/03/2020 à 15h00 :
visite...

Lire la suite

16 Mars 2020

Atelier : Cultiver son intelligence émotionnelle :
L'UnIPEF vous propose un atelier professionnel, animé par Cyrielle Barbot, directr...

Lire la suite

16 Mars 2020

Save-the-Date : Soirée-débat : Crises du logement, crise sociale : que peut-on attendre du logement social ? :
X-Ponts Pierre, groupe professionnel des anciens de l’X ou des Ponts travaillant dan...

Lire la suite

17 Mars 2020

Atelier - Réussir sa stratégie de recherche d emploi :
Réseauter et conduire sa recherche d'emploi...

Lire la suite

17 Mars 2020

Business Angels des Grandes Ecoles : Présentation de projets d'entrepreneurs :
PONTS Business Angels vous convie à la réunion mensuelle de présent...

Lire la suite

17 Mars 2020

Réunion de présentation de projets BADGE :
 Inscrivez-vous à la prochaine réunion  de pr...

Lire la suite

18 Mars 2020

Quelle place pour l’innovation dans le BTP d’aujourd’hui ? :
Innovation - Construction - Aménagement...

Lire la suite

19 Mars 2020

Soirée métiers du 19 mars :
BTP, Immobilier, Mécanique, R&D, Electronique, Production...

Lire la suite

19 Mars 2020

Décider & redécider sa vie professionnelle :
Pilotage de carrière - Employabilité...

Lire la suite

19 Mars 2020

Apér'Agro à Tours - Rdz-vs mensuel :
Soirée conviviale et réseautage...

Lire la suite

20 Mars 2020

Pré-Inscription - Réunion des Groupes Géographiques d'Intermines :
**IMPORTANT** Il s'agit ici d'une pré-inscription pour permettre à nos ca...

Lire la suite

23 Mars 2020

Carrières * Cycle de formation professionnelle : Le rôle du leader au sein d'une équipe :
se réinventer...

Lire la suite

Ajoutez un message personnel